PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00315.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 284aa    MW: 31600.8 Da    PI: 8.9825
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00315.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.5e-391675261
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk++
  Rsa1.0_00315.1_g00001.1 16 PQEKLNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGTLRNVPVGGSSRKNKRV 75
                             6899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-291574IPR003851Zinc finger, Dof-type
PfamPF027012.5E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8732074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
CNNNNTAVVV ERKARPQEKL NCPRCNSTNT KFCYYNNYSL TQPRYFCKGC RRYWTEGGTL  60
RNVPVGGSSR KNKRVPSSSS SNILLTTPSS LGLTTTLPDL NPNKSKGSSQ DLNLLSFPVM  120
QDQHQNHHVH MSQFLQMPKM EGNVNITHHQ PSALELLRRG VNVSSISYMP SGPVMDSSSN  180
VMYTSSGFPT MVDYKPSSLS FSTDHQGTGH NNHNRSDDTH HQGRVMFPFG DQMKEITSSI  240
TQEVDHDDNQ QQKSHGNNNN NNSSSPNNGY WSGMFSTTGG GSSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064181e-140AC006418.4 Arabidopsis thaliana chromosome 2 clone F13A10 map CIC06C03, complete sequence.
GenBankAJ2378101e-140AJ237810.1 Arabidopsis thaliana dag2 gene, exons 1-2.
GenBankAJ2378111e-140AJ237811.1 Arabidopsis thaliana mRNA for putative DNA binding protein (partial).
GenBankBT0033281e-140BT003328.1 Arabidopsis thaliana putative DOF zinc finger protein (At2g46590) mRNA, complete cds.
GenBankBT0088421e-140BT008842.1 Arabidopsis thaliana At2g46590 mRNA, complete cds.
GenBankCP0026851e-140CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142625.11e-172PREDICTED: dof zinc finger protein DOF2.5-like
RefseqXP_013747624.11e-172PREDICTED: dof zinc finger protein DOF2.5-like
SwissprotQ9ZPY01e-145DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLM4CJZ11e-172M4CJZ1_BRARP; Uncharacterized protein
STRINGBra004525.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46590.11e-129Dof family protein